PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462896542
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family MIKC_MADS
Protein Properties Length: 266aa    MW: 30267.2 Da    PI: 9.3649
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462896542genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF96.89e-314190150
               S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
     SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
               krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fs +g+lyey+
  462896542 41 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSGRGRLYEYA 90
               79***********************************************8 PP

2K-box1033.9e-341092055100
      K-box   5 sgks.leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                s++  ++e +a+++qqe+akL++ i++Lq+++R l+G+ ++s+sl++L+qLe +Lek+++kiR++Knell+++++++qk+e el+++n +Lr+k+ e
  462896542 109 SNTGtVAEVNAQYYQQESAKLRQTISSLQNSNRTLVGDAINSMSLRDLKQLEGRLEKGINKIRARKNELLYAEVDYMQKREMELHSDNLYLRTKVSE 205
                33335999**************************************************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006632.2543393IPR002100Transcription factor, MADS-box
SMARTSM004321.8E-393392IPR002100Transcription factor, MADS-box
CDDcd002651.73E-4434105No hitNo description
SuperFamilySSF554553.01E-3235105IPR002100Transcription factor, MADS-box
PROSITE patternPS0035003589IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-323555IPR002100Transcription factor, MADS-box
PfamPF003192.2E-264289IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-325570IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-327091IPR002100Transcription factor, MADS-box
PfamPF014867.3E-26118203IPR002487Transcription factor, K-box
PROSITE profilePS5129714.462119209IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048366Biological Processleaf development
GO:0048440Biological Processcarpel development
GO:0048443Biological Processstamen development
GO:0048497Biological Processmaintenance of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MLNMMADLSC GPSKVKEQPT PANSGPSAGS DKPARGKIEI KRIENTTNRQ VTFCKRRNGL  60
LKKAYELSVL CDAEVALIVF SGRGRLYEYA NHSVKATIER YKKANTDTSN TGTVAEVNAQ  120
YYQQESAKLR QTISSLQNSN RTLVGDAINS MSLRDLKQLE GRLEKGINKI RARKNELLYA  180
EVDYMQKREM ELHSDNLYLR TKVSENERGH EQPMGMQMEA ASTSEYEHMV PYDSRNFLQV  240
SIMQQPQHYT HHLQPTTLQL GQQQFS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_A3e-1934105172MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B3e-1934105172MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C3e-1934105172MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_D3e-1934105172MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3kov_A4e-1934105172Myocyte-specific enhancer factor 2A
3kov_B4e-1934105172Myocyte-specific enhancer factor 2A
3kov_I4e-1934105172Myocyte-specific enhancer factor 2A
3kov_J4e-1934105172Myocyte-specific enhancer factor 2A
3p57_A4e-1934105172Myocyte-specific enhancer factor 2A
3p57_B4e-1934105172Myocyte-specific enhancer factor 2A
3p57_C4e-1934105172Myocyte-specific enhancer factor 2A
3p57_D4e-1934105172Myocyte-specific enhancer factor 2A
3p57_I4e-1934105172Myocyte-specific enhancer factor 2A
3p57_J4e-1934105172Myocyte-specific enhancer factor 2A
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00609ChIP-seqTransfer from AT4G18960Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004968556.11e-155PREDICTED: MADS-box transcription factor 3 isoform X1
SwissprotQ407041e-142MADS3_ORYSJ; MADS-box transcription factor 3
TrEMBLA0A0A8XZ731e-175A0A0A8XZ73_ARUDO; Uncharacterized protein
STRINGSb03g002525.11e-151(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64937144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18960.11e-104MIKC_MADS family protein